Home / Products / Immune & Antimicrobial Peptide Research

Antimicrobial Peptide Research

LL-37

Synonym(s): LL-37, LL37, Cathelicidin LL-37, CAP-18, CAP18, Ropocamptide

  • CASSee batch/specification documentation
  • FormulaC205H340N60O53
  • Mol. weight4493 g/mol
  • EC / EINECSNot applicable

Documents

Safety Data Sheet (SDS) Certificate of Analysis Specification Sheet
LL-37 peptide 5 mg research vial

Packaging & availability

Pricing on request
SelectSKUPack sizePer boxAvailabilityPrice
LL375 5mg / 10vials 1 box 10vials/bos MOQ:100boxes or 1000vials On request

Add the sizes you need to a quote request — our team will follow up with pricing and lead time.

LL-37 Peptide

LL-37 is a 37-amino-acid peptide derived from the human cathelicidin antimicrobial peptide precursor. It is widely studied in laboratory research involving innate host-defense mechanisms and peptide biology.

Product Information

Product Name: LL-37
Synonyms: Cathelicidin LL-37, LL37, CAP-18, Ropocamptide
Sequence: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Molecular Formula: C205H340N60O53
Molecular Weight: 4493 g/mol
Form: Lyophilized powder
Grade: Research grade

Quality Control

Batch-specific analytical information, including applicable purity testing and Certificate of Analysis documentation, is available for individual production lots.

Packaging

LL-37 is supplied in research-use packaging. Available pack sizes and current availability are listed in the packaging table on this page.

Research Use Statement

For laboratory research use only. Not for human consumption, diagnostic use, or therapeutic use.

CASSee batch/specification documentation
Linear FormulaC205H340N60O53
Mol. weight4493 g/mol
Purity / Grade≥99%, HPLC, Lyophilized
MDL NumberNot available
EC / EINECSNot applicable
PubChem Substance ID16198951
Synonym(s)LL-37, LL37, Cathelicidin LL-37, CAP-18, CAP18, Ropocamptide
StorageStore at 2–8°C, protect from light

For research and manufacturing use only. Not for human or veterinary use, diagnosis, or treatment. Supplied to qualified businesses only.

Hazard statements

Always review the Safety Data Sheet before handling. Use appropriate personal protective equipment and follow your facility's chemical hygiene plan.

Download SDS

Related products

Vasoactive Intestinal Peptide VIP research peptide vials
Neuropeptide & Receptor Research

VIP

CAS
37221-79-7
Grade
≥99%, HPLC, Lyophilized

Vasoactive Intestinal Peptide; VIP; Vasoactive Intestinal Polypeptide; Aviptadil; UNII-6J2WVD66KR

Made to order View product
For research and manufacturing use only. Products are supplied to qualified businesses in compliance with the laws and regulations of the destination country. Not intended for personal, diagnostic, or therapeutic use unless duly registered and authorized.