LL-37 Peptide
LL-37 is a 37-amino-acid peptide derived from the human cathelicidin antimicrobial peptide precursor. It is widely studied in laboratory research involving innate host-defense mechanisms and peptide biology.
Product Information
Product Name: LL-37
Synonyms: Cathelicidin LL-37, LL37, CAP-18, Ropocamptide
Sequence: [LL-37, 37 aa]
Molecular Formula: C205H340N60O53
Molecular Weight: 4493 g/mol
Form: Lyophilized powder
Grade: Research grade
Quality Control
Batch-specific analytical information, including applicable purity testing and Certificate of Analysis documentation, is available for individual production lots.
Packaging
LL-37 is supplied in research-use packaging. Available pack sizes and current availability are listed in the packaging table on this page.
Research Use Statement
For laboratory research use only. Not for human consumption, diagnostic use, or therapeutic use.
