LL-37 Peptide Specification Sheet

Product Overview

LL-37 is a 37-amino-acid human cathelicidin peptide widely studied in laboratory research related to innate immune mechanisms, peptide biology, host-defense pathways, and cellular responses.

This specification sheet provides general product information, technical reference information, quality documentation details, and research-use information for LL-37 peptide supplied by 52ym.

Product Information

Item	Specification
Product Name	LL-37
Alternative Name	Human Cathelicidin LL-37
Product Type	Research Peptide
Peptide Length	37 amino acids
Molecular Formula	C205H340N60O53
Molecular Weight	Approx. 4493 g/mol
Application	Laboratory Research Use
Purity	Refer to batch-specific documentation
Storage	Refer to product label or batch documentation
Usage	Research purposes only

Technical Information

Product Name:
LL-37

Alternative Name:
Human Cathelicidin LL-37

Peptide Length:
37 amino acids

Sequence:
[LL-37, 37 aa]

Research Areas:
Peptide research
Innate immunity research
Host-defense peptide research
Cellular biology research
Molecular biology research

Quality Documentation

Available documentation may include:

• Product Specification Sheet
• Certificate of Analysis (COA)
• HPLC analytical documentation
• Mass spectrometry (MS) documentation
• Batch-specific quality information

Documentation availability may vary by batch. Please contact 52ym for current product documentation.

Research Use Statement

LL-37 peptide supplied by 52ym is intended strictly for laboratory research, analytical, and scientific research purposes.

This product is not intended for human consumption, clinical diagnosis, therapeutic use, or veterinary use.

Product / Quote

LL-37 Product Information

For LL-37 product specifications, batch documentation, availability, and quotation requests, visit the LL-37 product page.