Product Overview
LL-37 is a 37-amino-acid human cathelicidin peptide widely studied in laboratory research related to innate immune mechanisms, peptide biology, host-defense pathways, and cellular responses.
This specification sheet provides general product information, technical reference information, quality documentation details, and research-use information for LL-37 peptide supplied by 52ym.
Product Information
| Item | Specification |
|---|---|
| Product Name | LL-37 |
| Alternative Name | Human Cathelicidin LL-37 |
| Product Type | Research Peptide |
| Peptide Length | 37 amino acids |
| Molecular Formula | C205H340N60O53 |
| Molecular Weight | Approx. 4493 g/mol |
| Application | Laboratory Research Use |
| Purity | Refer to batch-specific documentation |
| Storage | Refer to product label or batch documentation |
| Usage | Research purposes only |
Technical Information
Product Name:
LL-37
Alternative Name:
Human Cathelicidin LL-37
Peptide Length:
37 amino acids
Sequence:
[LL-37, 37 aa]
Research Areas:
Peptide research
Innate immunity research
Host-defense peptide research
Cellular biology research
Molecular biology research
Quality Documentation
Available documentation may include:
- Product Specification Sheet
- Certificate of Analysis (COA)
- HPLC analytical documentation
- Mass spectrometry (MS) documentation
- Batch-specific quality information
Documentation availability may vary by batch. Please contact 52ym for current product documentation.
Research Use Statement
LL-37 peptide supplied by 52ym is intended strictly for laboratory research, analytical, and scientific research purposes.
This product is not intended for human consumption, clinical diagnosis, therapeutic use, or veterinary use.
Product / Quote
LL-37 Product Information
For LL-37 product specifications, batch documentation, availability, and quotation requests, visit the LL-37 product page.
Leave a Reply