20/09/2026 · Specification Sheets

LL-37 Peptide Specification Sheet

LL-37 peptide 5 mg research vial

Product Overview

LL-37 is a 37-amino-acid human cathelicidin peptide widely studied in laboratory research related to innate immune mechanisms, peptide biology, host-defense pathways, and cellular responses.

This specification sheet provides general product information, technical reference information, quality documentation details, and research-use information for LL-37 peptide supplied by 52ym.

Product Information

ItemSpecification
Product NameLL-37
Alternative NameHuman Cathelicidin LL-37
Product TypeResearch Peptide
Peptide Length37 amino acids
Molecular FormulaC205H340N60O53
Molecular WeightApprox. 4493 g/mol
ApplicationLaboratory Research Use
PurityRefer to batch-specific documentation
StorageRefer to product label or batch documentation
UsageResearch purposes only

Technical Information

Product Name:
LL-37

Alternative Name:
Human Cathelicidin LL-37

Peptide Length:
37 amino acids

Sequence:
[LL-37, 37 aa]

Research Areas:
Peptide research
Innate immunity research
Host-defense peptide research
Cellular biology research
Molecular biology research

Quality Documentation

Available documentation may include:

  • Product Specification Sheet
  • Certificate of Analysis (COA)
  • HPLC analytical documentation
  • Mass spectrometry (MS) documentation
  • Batch-specific quality information

Documentation availability may vary by batch. Please contact 52ym for current product documentation.

Research Use Statement

LL-37 peptide supplied by 52ym is intended strictly for laboratory research, analytical, and scientific research purposes.

This product is not intended for human consumption, clinical diagnosis, therapeutic use, or veterinary use.

Product / Quote

LL-37 Product Information

For LL-37 product specifications, batch documentation, availability, and quotation requests, visit the LL-37 product page.

Leave a Reply

Your email address will not be published. Required fields are marked *

Solo para uso en investigación y fabricación. Los productos se suministran a empresas cualificadas conforme a las leyes y normativas del país de destino. No destinados a uso personal, diagnóstico o terapéutico salvo que estén debidamente registrados y autorizados.